PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G123200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 363aa    MW: 40517.5 Da    PI: 8.1722
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G123200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-1366112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           r+ W+++Ed++l++ v  + ++ W+ Iar ++ gR++ qc++rw  yl
  Sobic.004G123200.1.p  66 RNTWSQDEDDILIQMVGPHCKNKWSDIARSIP-GRSRRQCQERWMYYL 112
                           789*****************************.***********9986 PP

2Myb_DNA-binding49.21.2e-15119163248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           ++W+++Ed  l++a++ +G++ W + a++++ gRt+k +k++w++++
  Sobic.004G123200.1.p 119 QPWSEQEDITLIRAHRIFGNK-WCKLAKHFP-GRTGKAIKNHWHTLM 163
                           79*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.66861112IPR017930Myb domain
SMARTSM007175.3E-1265114IPR001005SANT/Myb domain
SuperFamilySSF466899.52E-2765159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-1768116IPR009057Homeodomain-like
CDDcd001675.04E-1168112No hitNo description
PfamPF139218.7E-1669129No hitNo description
PROSITE profilePS5129421.597113167IPR017930Myb domain
SMARTSM007171.8E-14117165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-21117165IPR009057Homeodomain-like
CDDcd001671.92E-12120163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MRRSGDGVTT RRSSGSGRSS SCSREIDWIA DEHGGLQRPS KRFKAQEWKK TAECLSHKTG  60
NSVKRRNTWS QDEDDILIQM VGPHCKNKWS DIARSIPGRS RRQCQERWMY YLDPAVNNQP  120
WSEQEDITLI RAHRIFGNKW CKLAKHFPGR TGKAIKNHWH TLMNGKRNSD YVRGLTIDNK  180
CSGSIKSGQD SCINIQVAVD CPIRPKPEQG FTEDGRNAAL KKKGSDSMSS EWYVSVNVSE  240
GQIARSSLPV VTKEKEVLPS SSVDQKVSCV AAKFSTSLPK KELANCLEAP LNGLDAGLYP  300
AHDHVSIHDH FDDICSSANP ESPELHQLAN IAELLDMSYC DSLMIVPPDS PNDGNSMEGM  360
WY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-246916630127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794350.0HF679435.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB29 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453679.10.0hypothetical protein SORBIDRAFT_04g010280
TrEMBLA0A0C6WCK80.0A0A0C6WCK8_9POAL; ScMYB29 protein
STRINGSb04g010280.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16796912
Representative plantOGRP1780822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.23e-36Homeodomain-like protein